Structure of PDB 8qxl Chain B

Receptor sequence
>8qxlB (length=457) Species: 9606 (Homo sapiens) [Search protein sequence]
TMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQLGGGYYVFPGASHN
RFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGHGPF
SHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEE
DICFIKEQIVGPLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCH
HLGIQNNFDYKRFIKFARVCEVDNELRICARDKEVGNLYDMFHTRNSLHR
RAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTK
LTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKRE
DYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHVSFY
CKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRKSLYAARQYFVQ
WCADRNF
3D structure
PDB8qxl Platform-directed allostery and quaternary structure dynamics of SAMHD1 catalysis.
ChainB
Resolution2.82 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.5.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP B Y155 V156 R451 Y42 V43 R330
BS02 GTP B K116 V117 I118 R145 K3 V4 I5 R32
BS03 DTP B V117 N119 V4 N6
BS04 FE B H167 H206 D207 D311 H54 H93 D94 D190
BS05 MG B D207 H233 D94 H120
BS06 DCP B L150 H215 K312 Y315 Y374 L37 H102 K191 Y194 Y253
BS07 DTP B R333 R352 K354 K523 R212 R231 K233 K402
BS08 DTP B V156 F157 R372 V43 F44 R251
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003697 single-stranded DNA binding
GO:0003723 RNA binding
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008270 zinc ion binding
GO:0008832 dGTPase activity
GO:0016787 hydrolase activity
GO:0016793 triphosphoric monoester hydrolase activity
GO:0032567 dGTP binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0106375 deoxynucleoside triphosphate hydrolase activity
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006203 dGTP catabolic process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0006955 immune response
GO:0006974 DNA damage response
GO:0009264 deoxyribonucleotide catabolic process
GO:0016446 somatic hypermutation of immunoglobulin genes
GO:0045087 innate immune response
GO:0045088 regulation of innate immune response
GO:0046061 dATP catabolic process
GO:0051289 protein homotetramerization
GO:0051607 defense response to virus
GO:0060339 negative regulation of type I interferon-mediated signaling pathway
GO:0110025 DNA strand resection involved in replication fork processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005886 plasma membrane
GO:0035861 site of double-strand break
GO:0097197 tetraspanin-enriched microdomain

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qxl, PDBe:8qxl, PDBj:8qxl
PDBsum8qxl
PubMed38710701
UniProtQ9Y3Z3|SAMH1_HUMAN Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 (Gene Name=SAMHD1)

[Back to BioLiP]