Structure of PDB 8quc Chain B

Receptor sequence
>8qucB (length=395) Species: 9606 (Homo sapiens) [Search protein sequence]
SERIVINVGGTRHQTHRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFF
FDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCW
MTYRQHRDAEEALDRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSIT
TFCLETHERFNPIVNKTYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCP
NKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRI
LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAER
IGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGA
LCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRP
3D structure
PDB8quc The binding and mechanism of a positive allosteric modulator of Kv3 channels.
ChainB
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 WY9 B V312 F315 V244 F247
BS02 WY9 B M362 Y365 R368 G370 A371 P373 M294 Y297 R300 G302 A303 P305
BS03 Y01 B N276 L278 F322 R326 L331 L334 N208 L210 F254 R258 L263 L266
BS04 Y01 B F351 G355 T427 F283 G287 T359
Gene Ontology
Molecular Function
GO:0005216 monoatomic ion channel activity
GO:0005249 voltage-gated potassium channel activity
GO:0005251 delayed rectifier potassium channel activity
GO:0005267 potassium channel activity
GO:0005515 protein binding
GO:0019894 kinesin binding
GO:0044325 transmembrane transporter binding
GO:0099508 voltage-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
Biological Process
GO:0001508 action potential
GO:0006811 monoatomic ion transport
GO:0006813 potassium ion transport
GO:0009636 response to toxic substance
GO:0009642 response to light intensity
GO:0010996 response to auditory stimulus
GO:0014075 response to amine
GO:0021549 cerebellum development
GO:0021554 optic nerve development
GO:0021759 globus pallidus development
GO:0022038 corpus callosum development
GO:0034765 regulation of monoatomic ion transmembrane transport
GO:0034767 positive regulation of monoatomic ion transmembrane transport
GO:0035864 response to potassium ion
GO:0051260 protein homooligomerization
GO:0051262 protein tetramerization
GO:0055085 transmembrane transport
GO:0071466 cellular response to xenobiotic stimulus
GO:0071774 response to fibroblast growth factor
GO:0071805 potassium ion transmembrane transport
GO:0099505 regulation of presynaptic membrane potential
GO:1901379 regulation of potassium ion transmembrane transport
GO:1901381 positive regulation of potassium ion transmembrane transport
GO:1990089 response to nerve growth factor
Cellular Component
GO:0005886 plasma membrane
GO:0008076 voltage-gated potassium channel complex
GO:0009986 cell surface
GO:0016020 membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0030673 axolemma
GO:0032589 neuron projection membrane
GO:0032590 dendrite membrane
GO:0032809 neuronal cell body membrane
GO:0034702 monoatomic ion channel complex
GO:0042734 presynaptic membrane
GO:0042995 cell projection
GO:0043025 neuronal cell body
GO:0043679 axon terminus
GO:0044305 calyx of Held
GO:0045202 synapse
GO:0045211 postsynaptic membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8quc, PDBe:8quc, PDBj:8quc
PDBsum8quc
PubMed38514618
UniProtP48547|KCNC1_HUMAN Voltage-gated potassium channel KCNC1 (Gene Name=KCNC1)

[Back to BioLiP]