Structure of PDB 8qu2 Chain B

Receptor sequence

>8qu2B (length=87) Species: 9606 (Homo sapiens)

IYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCH
QEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE

3D structure

• PDB: 8qu2 Binding dynamics of a stapled peptide targeting the transcription factor NF-Y.
• Chain: B
• Resolution: 1.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E92 S95 F96 S99 E100 E103 L125 F127	E36 S39 F40 S43 E44 E47 L69 F71

Gene Ontology

Molecular Function

• GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
• GO:0043565 sequence-specific DNA binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0016602 CCAAT-binding factor complex

External links

• PDB: RCSB:8qu2, PDBe:8qu2, PDBj:8qu2
• PDBsum: 8qu2
• PubMed: 38470946
• UniProt: P25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta (Gene Name=NFYB)