Structure of PDB 8qhk Chain B

Receptor sequence

>8qhkB (length=418) Species: 224324 (Aquifex aeolicus VF5)

RSYPAIPRIYAETTLNMLLKRAKKPRVHSIDEYLKDGGYQALEKALNMSP
EEIIDWVDKSTLRGRGGAGFPTGKKWKFAVQNPGPRYFICNADESEPGTF
KDRIIIERDPHLLIEGIIISSYAIGANEAYIYIRGEYPAGYYILRDAIEE
AKKKGFLGKNILGSGFDLEIYVARGAGAYICGEETALIESLEGKRGHPRL
KPPYPVQKGLWGKPTVVNNVETIANVPFIISMGWEEYRYIGPSDYAGPKL
FPVSGKVKKPGVYELPMNTTLREVIFKYAGGTLGNKKVKAVFSGALDCFS
SEELDIPMDYSPLGFGGTGTVIVLTEEDDIVEAALKIAEFYEHETCGQCT
PCRVGCYEQANLLEKIYKGEATEQDWEGFDFVNRNIQPTSICGLGAVAGR
LIRQTLEKFPEEWEKYRK

3D structure

• PDB: 8qhk Structures of 3-acetylpyridine adenine dinucleotide and ADP-ribose bound to the electron input module of respiratory complex I.
• Chain: B
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	P199 T346 C347 G348 Q349 C350 C353 S391 I392 C393 L395 G396	P198 T345 C346 G347 Q348 C349 C352 S390 I391 C392 L394 G395
BS02	FNR	B	G65 G67 K76 N92 D94 E95 G183 E184 N219 N220 T223	G64 G66 K75 N91 D93 E94 G182 E183 N218 N219 T222
BS03	AP0	B	G67 G68 A69 F71 K76 E95 E97 Y180 E185 Y205	G66 G67 A68 F70 K75 E94 E96 Y179 E184 Y204

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:1902600 proton transmembrane transport

External links

• PDB: RCSB:8qhk, PDBe:8qhk, PDBj:8qhk
• PDBsum: 8qhk
• PubMed: 38503292
• UniProt: O66841|NUOF_AQUAE NADH-quinone oxidoreductase subunit F (Gene Name=nuoF)