Structure of PDB 8qg1 Chain B

Receptor sequence

>8qg1B (length=417) Species: 224324 (Aquifex aeolicus VF5)

SYPAIPRIYAETTLNMLLKRAKKPRVHSIDEYLKDGGYQALEKALNMSPE
EIIDWVDKSTLRGRGGAGFPTGKKWKFAVQNPGPRYFICNADESEPGTFK
DRIIIERDPHLLIEGIIISSYAIGANEAYIYIRGEYPAGYYILRDAIEEA
KKKGFLGKNILGSGFDLEIYVARGAGAYICGEETALIESLEGKRGHPRLK
PPYPVQKGLWGKPTVVNNVETIANVPFIISMGWEEYRYIGPSDYAGPKLF
PVSGKVKKPGVYELPMNTTLREVIFKYAGGTLGNKKVKAVFSGALDCFSS
EELDIPMDYSPLGFGGTGTVIVLTEEDDIVEAALKIAEFYEHETCGQCTP
CRVGCYEQANLLEKIYKGEATEQDWEGFDFVNRNIQPTSICGLGAVAGRL
IRQTLEKFPEEWEKYRK

3D structure

• PDB: 8qg1 Structures of 3-acetylpyridine adenine dinucleotide and ADP-ribose bound to the electron input module of respiratory complex I.
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	P199 T346 C347 G348 Q349 C350 C353 I392 C393 L395 G396	P197 T344 C345 G346 Q347 C348 C351 I390 C391 L393 G394
BS02	FMN	B	G65 G67 K76 N92 D94 E95 Y180 G183 E184 V218 N219 N220 T223	G63 G65 K74 N90 D92 E93 Y178 G181 E182 V216 N217 N218 T221
BS03	APR	B	G68 A69 F71 K76 E185 Y205	G66 A67 F69 K74 E183 Y203

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:1902600 proton transmembrane transport

External links

• PDB: RCSB:8qg1, PDBe:8qg1, PDBj:8qg1
• PDBsum: 8qg1
• PubMed: 38503292
• UniProt: O66841|NUOF_AQUAE NADH-quinone oxidoreductase subunit F (Gene Name=nuoF)