Structure of PDB 8qfr Chain B |
>8qfrB (length=144) Species: 1073253 (Thermocatellispora tengchongensis) [Search protein sequence] |
GELDLPERNLDRRELRDLVNELAAHPERWAEHVYASLHRDAYVDVWLLCW RAEDDTGWHDHDISSGAVRVVAGALKECNPRIGGEHLETVVSEGESFSFG PDHIHRLTGAVHGSVSIHAYSPPLWRLGQYSIDDSGVMRRVSVS |
|
PDB | 8qfr Ergothioneine dioxygenase from Thermocatellispora tengchongensis in complex with nickel and substrate (anaerobic) |
Chain | B |
Resolution | 2.2 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
R33 R36 S127 |
R13 R16 S98 |
|
|
|