Structure of PDB 8qc2 Chain B

Receptor sequence

>8qc2B (length=363) Species: 37931 (Paenarthrobacter ureafaciens)

AQTIRYGLIGAGHMAREHVRNLALIPGSLITAVADPTPSSLEETAREIGY
DVQTFSAHKDLLASGLVDALVIASPNDTHLEILKDIFASGTNLPVLVEKP
VCTSAEQADELEELAATYTAPVWVAMEYRYMPPVQEIIQAAHSGKLGNIH
MLSIVEHRFPFLHKVDAWNRFAERTGGTLVEKCCHFFDLMRLILQDEPTR
IYASGGHDVNHMDEVYDGLISDMVDNAYVIVDFKGGRRAMLELSMFAEGS
KFQERISIVGDAAKIETLIPVAANHWIEGDETEATVEFSPRSPLGPEKHE
VPVDEAVLAAGAHHGSTYYEHLGYRKAILGEGPVDVTVADGLQSVRMGLA
AEQSIIEGRAVEL

3D structure

• PDB: 8qc2 Widespread Family of NAD + -Dependent Sulfoquinovosidases at the Gateway to Sulfoquinovose Catabolism.
• Chain: B
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	B	G20 H21 M22 D43 P44 T45 S48 A81 S82 P83 N84 H87 E106 K107 E135 K172 V173 W176 H321	G12 H13 M14 D35 P36 T37 S40 A73 S74 P75 N76 H79 E98 K99 E127 K164 V165 W168 H313
BS02	R7R	B	K107 Y136 R166 F169 L170 K172 E189 K190 H193 H321	K99 Y128 R158 F161 L162 K164 E181 K182 H185 H313

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Feb 19 07:31:09 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8qc2', asym_id = 'B', title = 'Widespread Family of NAD + -Dependent Sulfoquino...ases at the Gateway to Sulfoquinovose Catabolism.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8qc2', asym_id='B', title='Widespread Family of NAD + -Dependent Sulfoquino...ases at the Gateway to Sulfoquinovose Catabolism.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000166', uniprot = '', pdbid = '8qc2', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000166', uniprot='', pdbid='8qc2', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>