Structure of PDB 8q9p Chain B

Receptor sequence
>8q9pB (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
GRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGF
3D structure
PDB8q9p Folding of Class IIa HDAC Derived Peptides into alpha-helices Upon Binding to Myocyte Enhancer Factor-2 in Complex with DNA.
ChainB
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B Y69 T70 Y72 N73 E74 H76 Y68 T69 Y71 N72 E73 H75
BS02 dna B G2 R3 K23 R24 K30 F93 G1 R2 K22 R23 K29 F92
BS03 dna B G2 R3 K5 K31 G1 R2 K4 K30
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8q9p, PDBe:8q9p, PDBj:8q9p
PDBsum8q9p
PubMed38492719
UniProtQ05BX2

[Back to BioLiP]