Structure of PDB 8q9n Chain B

Receptor sequence
>8q9nB (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
GRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFN
3D structure
PDB8q9n Folding of Class IIa HDAC Derived Peptides into alpha-helices Upon Binding to Myocyte Enhancer Factor-2 in Complex with DNA.
ChainB
Resolution1.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B G2 R3 K23 R24 K30 N94 G1 R2 K22 R23 K29 N93
BS02 dna B G2 R3 K5 K31 G1 R2 K4 K30
BS03 peptide B D63 L67 Y69 T70 Y72 E74 H76 D62 L66 Y68 T69 Y71 E73 H75
External links