Structure of PDB 8q8o Chain B |
>8q8oB (length=138) Species: 208963 (Pseudomonas aeruginosa UCBPP-PA14) [Search protein sequence] |
RVWNARSLAEALSGTELFSSGEAQIELIEGAEASLYVIMREYGDLPVFVA PQGEQIIVEALLWPESDVTDATAFNEEVLLSRQLFPLSSIGLLNEERCYS MFGALSTTSSLASVLHEIETLAGNVIRATEVYAGYLKA |
|
PDB | 8q8o BacA: a possible regulator that contributes to the biofilm formation of Pseudomonas aeruginosa |
Chain | B |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
7MT |
B |
A109 E112 |
A73 E76 |
|
|
|