Structure of PDB 8prv Chain B

Receptor sequence

>8prvB (length=163) Species: 4932 (Saccharomyces cerevisiae)

IADEPVKASLLLHVLVAHKLKKSLDSIPMSKTIKDLVGGKSTVQNEILGD
LGKEFGTTPEKPEETPLEELAETFQDTFSGALGKQSSSLLSRLISSKMPG
GFTITVARKYLQTRWGLPSGRQDGVLLVALSNEPAARLGSEADAKAFLDS
MAQKYASIVGVDL

3D structure

• PDB: 8prv Reconstruction of a fatty acid synthesis cycle from acyl carrier protein and cofactor structural snapshots.
• Chain: B
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
  2.3.1.41: beta-ketoacyl-[acyl-carrier-protein] synthase I.
  2.3.1.86: fatty-acyl-CoA synthase system.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	A5S	B	S180 T181	S41 T42

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004312 fatty acid synthase activity
• GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity
• GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
• GO:0004321 fatty-acyl-CoA synthase activity
• GO:0005515 protein binding
• GO:0008897 holo-[acyl-carrier-protein] synthase activity
• GO:0016491 oxidoreductase activity
• GO:0016740 transferase activity
• GO:0016746 acyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0042759 long-chain fatty acid biosynthetic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005829 cytosol
• GO:0005835 fatty acid synthase complex

External links

• PDB: RCSB:8prv, PDBe:8prv, PDBj:8prv
• PDBsum: 8prv
• PubMed: 37949058
• UniProt: P19097|FAS2_YEAST Fatty acid synthase subunit alpha (Gene Name=FAS2)