Structure of PDB 8pmp Chain B

Receptor sequence
>8pmpB (length=152) Species: 9606 (Homo sapiens) [Search protein sequence]
GLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTE
EQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYING
TRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLA
QN
3D structure
PDB8pmp Structural basis for competitive binding of productive and degradative co-transcriptional effectors to the nuclear cap-binding complex.
ChainB
Resolution3.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B F49 Y50 K67 L73 M76 K77 K78 T79 F46 Y47 K64 L70 M73 K74 K75 T76
BS02 MGT B Y20 Q23 Y43 F85 D114 W115 D116 R123 G126 R127 Q133 V134 Y17 Q20 Y40 F82 D111 W112 D113 R120 G123 R124 Q130 V131
Gene Ontology
Molecular Function
GO:0000339 RNA cap binding
GO:0000340 RNA 7-methylguanosine cap binding
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0017069 snRNA binding
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000380 alternative mRNA splicing, via spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0002191 cap-dependent translational initiation
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0006408 snRNA export from nucleus
GO:0006417 regulation of translation
GO:0006446 regulation of translational initiation
GO:0008334 histone mRNA metabolic process
GO:0008380 RNA splicing
GO:0016071 mRNA metabolic process
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031053 primary miRNA processing
GO:0031124 mRNA 3'-end processing
GO:0031442 positive regulation of mRNA 3'-end processing
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0035194 regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035195 miRNA-mediated post-transcriptional gene silencing
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045292 mRNA cis splicing, via spliceosome
GO:0046833 positive regulation of RNA export from nucleus
GO:0051028 mRNA transport
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005846 nuclear cap binding complex
GO:0034518 RNA cap binding complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pmp, PDBe:8pmp, PDBj:8pmp
PDBsum8pmp
PubMed38175753
UniProtP52298|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 (Gene Name=NCBP2)

[Back to BioLiP]