Structure of PDB 8pk9 Chain B

Receptor sequence
>8pk9B (length=81) Species: 9606 (Homo sapiens) [Search protein sequence]
SRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQT
LVNKAKRDLGVIRRQVHIGQLYSTDKLIIEN
3D structure
PDB8pk9 Mechanism and structural dynamics of sulfur transfer during de novo [2Fe-2S] cluster assembly on ISCU2.
ChainB
Resolution2.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 8Q1 B R6 V9 A39 F40 N43 K44 V46 I52 D62 R2 V5 A35 F36 N39 K40 V42 I48 D58
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0016226 iron-sulfur cluster assembly
GO:0044571 [2Fe-2S] cluster assembly
GO:0044572 [4Fe-4S] cluster assembly
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0016604 nuclear body
GO:0099128 mitochondrial [2Fe-2S] assembly complex
GO:1990221 L-cysteine desulfurase complex
GO:1990229 iron-sulfur cluster assembly complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pk9, PDBe:8pk9, PDBj:8pk9
PDBsum8pk9
PubMed38627381
UniProtQ9HD34|LYRM4_HUMAN LYR motif-containing protein 4 (Gene Name=LYRM4)

[Back to BioLiP]