Structure of PDB 8pe3 Chain B

Receptor sequence

>8pe3B (length=379) Species: 1308 (Streptococcus thermophilus)

AMGVLISAVGDTDPFRNFHDGALIHIARKYRPEKVILIFSEHTAKKQGNI
EKALFSIAPNYEPELIIHDPIISDNEVHIFDVMFQRFSDILQEYYTKEDE
FILNLSSATPQIKSALFVINRLNGINVKAVQVSSPEHASNENIGHDNDEN
IDELIEVNKDNKVNFIDRTIEDNAEKFSQALLKKTARDFIEKFDYKAALD
ILDQLSDFPNLKSVREEIRDVVNCLSKQDVPKGLRHKKLKEEEQKILSAY
LTIELQRERGNVSESFIRIKNLTEFILEDYIKKRYPGLIDEYCEDYLSLF
DYSKLLKATKEFKLKRTIAPIIDMNSSRNSLSPLDSDAVKQLGIAMKTLK
TLVREQYHFSQSDFNFYQDLNKILLTKLN

3D structure

• PDB: 8pe3 Activation of Csm6 ribonuclease by cyclic nucleotide binding: in an emergency, twist to open.
• Chain: B
• Resolution: 1.96 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	G9 D10 T11 R15 D19 S39 H41 D73 H77 S105 A107 T108 P109 K112 S132 P134 H136 A137 S138 N139	G10 D11 T12 R16 D20 S40 H42 D74 H78 S106 A108 T109 P110 K113 S133 P135 H137 A138 S139 N140
BS02	rna	B	G9 D10 T11 S39 D73 V76 H77 A107 T108 Q110	G10 D11 T12 S40 D74 V77 H78 A108 T109 Q111
BS03	rna	B	T11 R15 D19 S105 K112 V131 S132 S133 P134 H136 A137 S138 N139 R167	T12 R16 D20 S106 K113 V132 S133 S134 P135 H137 A138 S139 N140 R168

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003723 RNA binding
• GO:0004519 endonuclease activity

Biological Process

• GO:0051607 defense response to virus

External links

• PDB: RCSB:8pe3, PDBe:8pe3, PDBj:8pe3
• PDBsum: 8pe3
• PubMed: 37747760
• UniProt: A0A0A7HFE6|CSM6B_STRTR CRISPR system endoribonuclease Csm6' (Gene Name=csm6')