Structure of PDB 8p94 Chain B

Receptor sequence
>8p94B (length=394) Species: 9606 (Homo sapiens) [Search protein sequence]
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNI
EIKDLMVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNI
DTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQG
LLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLR
GYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGR
IIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR
KHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
3D structure
PDB8p94 Molecular visualization of how cortactin stabilizes Arp2/3-complex nucleated actin branches
ChainB
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B E75 I78 P116 R181 E75 I78 P116 R181
BS02 ADP B G14 T15 G16 F17 D161 R214 K217 E218 G306 M309 Y310 K351 G14 T15 G16 F17 D161 R214 K217 E218 G306 M309 Y310 K351
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0051015 actin filament binding
Biological Process
GO:0007163 establishment or maintenance of cell polarity
GO:0008356 asymmetric cell division
GO:0010592 positive regulation of lamellipodium assembly
GO:0016344 meiotic chromosome movement towards spindle pole
GO:0016482 cytosolic transport
GO:0030036 actin cytoskeleton organization
GO:0033206 meiotic cytokinesis
GO:0034314 Arp2/3 complex-mediated actin nucleation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051321 meiotic cell cycle
GO:0051653 spindle localization
GO:0060271 cilium assembly
GO:0071346 cellular response to type II interferon
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2001032 regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005885 Arp2/3 protein complex
GO:0005925 focal adhesion
GO:0005938 cell cortex
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0030478 actin cap
GO:0035578 azurophil granule lumen
GO:0035861 site of double-strand break
GO:0042995 cell projection
GO:0070062 extracellular exosome
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p94, PDBe:8p94, PDBj:8p94
PDBsum8p94
PubMed38267598
UniProtP61160|ARP2_HUMAN Actin-related protein 2 (Gene Name=ACTR2)

[Back to BioLiP]