Structure of PDB 8p66 Chain B |
>8p66B (length=54) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
MARKQCQVCGQPATVRVEANLNGRHSTMLLCDDHYRQLVRQQKRTVWSHP QFEK |
|
PDB | 8p66 Structural basis of aggregate binding by the AAA+ disaggregase ClpG. |
Chain | B |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
C6 C9 C31 H34 |
C6 C9 C31 H34 |
|
|
|