Structure of PDB 8owu Chain B |
>8owuB (length=76) Species: 1053183 (Bacillus cereus BAG3X2-1) [Search protein sequence] |
FQGMTKKEILEKLPEGWKYTENNGFVHVRDANDTIRMRIAPPDKVTKYDH VHLYDENKNPLDLNGNIVDPDAHIPY |
|
PDB | 8owu Systematic Discovery of Antibacterial and Antifungal Bacterial Toxins |
Chain | B |
Resolution | 2.54 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
H47 H49 H73 |
H50 H52 H73 |
|
|
|