Structure of PDB 8ow0 Chain B

Receptor sequence
>8ow0B (length=107) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
EWKKQRKDSHKEVERRRRENINTAINVLSDLLPVRESSKAAILACAAEYI
QKLKETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYMK
RVLRKEG
3D structure
PDB8ow0 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
ChainB
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B W219 R223 H227 R234 W2 R6 H10 R17
BS02 dna B K224 H227 K228 E231 K7 H10 K11 E14
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0019237 centromeric DNA binding
GO:0046983 protein dimerization activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006338 chromatin remodeling
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007059 chromosome segregation
GO:0042762 regulation of sulfur metabolic process
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0061431 cellular response to methionine
GO:1900059 positive regulation of sulfate assimilation
GO:1900060 negative regulation of ceramide biosynthetic process
GO:1900090 positive regulation of inositol biosynthetic process
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005739 mitochondrion
GO:0089713 Cbf1-Met4-Met28 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ow0, PDBe:8ow0, PDBj:8ow0
PDBsum8ow0
PubMed37506202
UniProtP17106|CBF1_YEAST Centromere-binding protein 1 (Gene Name=CBF1)

[Back to BioLiP]