Structure of PDB 8ovw Chain B |
>8ovwB (length=107) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
EWKKQRKDSHKEVERRRRENINTAINVLSDLLPVRESSKAAILACAAEYI QKLKETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYMK RVLRKEG |
|
PDB | 8ovw Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere. |
Chain | B |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Molecular Function |
GO:0000978 |
RNA polymerase II cis-regulatory region sequence-specific DNA binding |
GO:0001227 |
DNA-binding transcription repressor activity, RNA polymerase II-specific |
GO:0001228 |
DNA-binding transcription activator activity, RNA polymerase II-specific |
GO:0003677 |
DNA binding |
GO:0003700 |
DNA-binding transcription factor activity |
GO:0019237 |
centromeric DNA binding |
GO:0046983 |
protein dimerization activity |
GO:0061629 |
RNA polymerase II-specific DNA-binding transcription factor binding |
|
|