Structure of PDB 8ost Chain B

Receptor sequence
>8ostB (length=42) Species: 9606 (Homo sapiens) [Search protein sequence]
GDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLK
3D structure
PDB8ost Structural basis for activity switching in polymerases determining the fate of let-7 pre-miRNAs
ChainB
Resolution3.69 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna B R138 Y140 N141 A149 H162 M170 V171 R3 Y5 N6 A14 H27 M35 V36
BS02 ZN B C139 H147 C152 C4 H12 C17
BS03 ZN B C164 C174 C29 C39
Gene Ontology
Molecular Function
GO:0002151 G-quadruplex RNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0031369 translation initiation factor binding
GO:0035198 miRNA binding
GO:0046872 metal ion binding
GO:0070883 pre-miRNA binding
GO:0140517 protein-RNA adaptor activity
GO:1990825 sequence-specific mRNA binding
Biological Process
GO:0007281 germ cell development
GO:0010586 miRNA metabolic process
GO:0010587 miRNA catabolic process
GO:0010629 negative regulation of gene expression
GO:0017148 negative regulation of translation
GO:0019827 stem cell population maintenance
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0031123 RNA 3'-end processing
GO:0032008 positive regulation of TOR signaling
GO:0045666 positive regulation of neuron differentiation
GO:0045686 negative regulation of glial cell differentiation
GO:0045727 positive regulation of translation
GO:0048863 stem cell differentiation
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0060964 regulation of miRNA-mediated gene silencing
GO:0071076 RNA 3' uridylation
GO:0071333 cellular response to glucose stimulus
GO:1901724 positive regulation of cell proliferation involved in kidney development
GO:2000632 negative regulation of pre-miRNA processing
GO:2000767 positive regulation of cytoplasmic translation
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ost, PDBe:8ost, PDBj:8ost
PDBsum8ost
PubMed39054354
UniProtQ9H9Z2|LN28A_HUMAN Protein lin-28 homolog A (Gene Name=LIN28A)

[Back to BioLiP]