Structure of PDB 8ohd Chain B

Receptor sequence
>8ohdB (length=403) Species: 9606 (Homo sapiens) [Search protein sequence]
MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPE
SEEIAQLLSGSYIHYFHCLRILDLKDWQEIIALYEKDNTYLVELSSLLVR
NVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGI
TGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPT
EQVLPMLRFVQKRGNSTVYEWRTGTEPSVVVARGPDALTLLEYTETRNQF
LDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVS
VLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKEL
MVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMG
TSL
3D structure
PDB8ohd UFM1 E3 ligase promotes recycling of 60S ribosomal subunits from the ER
ChainB
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B Q151 E159 H163 Q131 E139 H143
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0030332 cyclin binding
GO:0044389 ubiquitin-like protein ligase binding
GO:0051019 mitogen-activated protein kinase binding
GO:0051059 NF-kappaB binding
GO:0097371 MDM2/MDM4 family protein binding
GO:1990756 ubiquitin-like ligase-substrate adaptor activity
Biological Process
GO:0000079 regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0001889 liver development
GO:0001933 negative regulation of protein phosphorylation
GO:0007095 mitotic G2 DNA damage checkpoint signaling
GO:0007346 regulation of mitotic cell cycle
GO:0007420 brain development
GO:0008283 cell population proliferation
GO:0010921 regulation of phosphatase activity
GO:0030262 apoptotic nuclear changes
GO:0030968 endoplasmic reticulum unfolded protein response
GO:0031398 positive regulation of protein ubiquitination
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0032790 ribosome disassembly
GO:0034976 response to endoplasmic reticulum stress
GO:0042177 negative regulation of protein catabolic process
GO:0043407 negative regulation of MAP kinase activity
GO:0044387 negative regulation of protein kinase activity by regulation of protein phosphorylation
GO:0044818 mitotic G2/M transition checkpoint
GO:0045664 regulation of neuron differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060318 definitive erythrocyte differentiation
GO:0071569 protein ufmylation
GO:0071901 negative regulation of protein serine/threonine kinase activity
GO:0072344 rescue of stalled ribosome
GO:0140501 positive regulation of reticulophagy
GO:1900182 positive regulation of protein localization to nucleus
GO:1901798 positive regulation of signal transduction by p53 class mediator
GO:2000060 positive regulation of ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ohd, PDBe:8ohd, PDBj:8ohd
PDBsum8ohd
PubMed38383785
UniProtQ96JB5|CK5P3_HUMAN CDK5 regulatory subunit-associated protein 3 (Gene Name=CDK5RAP3)

[Back to BioLiP]