Structure of PDB 8kfu Chain B

Receptor sequence

>8kfuB (length=163) Species: 4577 (Zea mays) [Search protein sequence]

GWVIGVDPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPKDDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP

3D structure

PDB

8kfu MOC1 cleaves Holliday junctions through a cooperative nick and counter-nick mechanism mediated by metal ions.

Chain

Resolution

2.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	D117 I118 R148 K175 S177 F179 P180 D182 Q185 G186 W187 S189 A212 S213 Q214 K217 M223 R224 K229 E257	D9 I10 R40 K67 S69 F71 P72 D74 Q77 G78 W79 S81 A104 S105 Q106 K109 M115 R116 K121 E149
BS02	dna	B	V143 S144 E145 R148 D182 G183 K184 Q185 G186 L249 K250 K251	V35 S36 E37 R40 D74 G75 K76 Q77 G78 L141 K142 K143
BS03	MN	B	D115 D117 E257	D7 D9 E149
BS04	MN	B	D115 E174 E257	D7 E66 E149

External links

PDB	RCSB:8kfu, PDBe:8kfu, PDBj:8kfu
PDBsum	8kfu
PubMed	38886375
UniProt	B4FCI7

[Back to BioLiP]