Structure of PDB 8kei Chain B

Receptor sequence
>8keiB (length=534) Species: 9606 (Homo sapiens) [Search protein sequence]
VNEGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARA
PAACLNFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVA
WMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNF
ARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVF
WYTHHLFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIK
ECPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPF
KTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHI
RIVGDWTEGLFNACGCDKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGV
TPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLES
QMQERNNAGFLSYNIYLTGWQKTLYGRPNWDNEFKTIASQHPNTRIGVFL
CGPEALAETLSKQSISNSESGPRGVHFIFNKENF
3D structure
PDB8kei Cryo-EM structure of NADPH oxidase 2 in complex with p22phox and EROS
ChainB
Resolution3.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.-.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B A57 H115 T116 H119 A175 G179 I182 L219 H222 R226 I227 A52 H110 T111 H114 A170 G174 I177 L214 H217 R221 I222
BS02 HEM B L98 H101 A105 I189 F205 H209 L93 H96 A100 I184 F200 H204
BS03 LBN B G47 S48 I117 W125 G42 S43 I112 W120
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0016175 superoxide-generating NAD(P)H oxidase activity
GO:0016491 oxidoreductase activity
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0050660 flavin adenine dinucleotide binding
GO:0050664 oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
Biological Process
GO:0006801 superoxide metabolic process
GO:0006952 defense response
GO:0006954 inflammatory response
GO:0007584 response to nutrient
GO:0009410 response to xenobiotic stimulus
GO:0032760 positive regulation of tumor necrosis factor production
GO:0034220 monoatomic ion transmembrane transport
GO:0042554 superoxide anion generation
GO:0045087 innate immune response
GO:0045730 respiratory burst
GO:0045766 positive regulation of angiogenesis
GO:0050665 hydrogen peroxide biosynthetic process
GO:0071276 cellular response to cadmium ion
GO:0071361 cellular response to ethanol
GO:0071456 cellular response to hypoxia
GO:0097411 hypoxia-inducible factor-1alpha signaling pathway
GO:1904044 response to aldosterone
GO:1904845 cellular response to L-glutamine
GO:1990776 response to angiotensin
Cellular Component
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0030425 dendrite
GO:0030670 phagocytic vesicle membrane
GO:0034702 monoatomic ion channel complex
GO:0035579 specific granule membrane
GO:0043020 NADPH oxidase complex
GO:0043025 neuronal cell body
GO:0045335 phagocytic vesicle
GO:0070821 tertiary granule membrane
GO:0097038 perinuclear endoplasmic reticulum

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kei, PDBe:8kei, PDBj:8kei
PDBsum8kei
PubMed
UniProtP04839|CY24B_HUMAN Cytochrome b-245 heavy chain (Gene Name=CYBB)

[Back to BioLiP]