Structure of PDB 8kcb Chain B

Receptor sequence
>8kcbB (length=89) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
SRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLEL
AGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIAN
3D structure
PDB8kcb Mechanism of heterochromatin remodeling revealed by the DDM1 bound nucleosome structures.
ChainB
Resolution3.17 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B K36 R43 V44 G45 A46 K20 R27 V28 G29 A30
BS02 dna B S17 R18 G29 R78 S1 R2 G13 R62
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0009294 DNA-mediated transformation
GO:0009611 response to wounding
GO:0009617 response to bacterium
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8kcb, PDBe:8kcb, PDBj:8kcb
PDBsum8kcb
PubMed38870940
UniProtQ9LD28|H2A6_ARATH Histone H2A.6 (Gene Name=RAT5)

[Back to BioLiP]