Structure of PDB 8jjn Chain B

Receptor sequence

>8jjnB (length=314) Species: 34073 (Variovorax paradoxus)

NPSLVIVSPAGNWRTAQRWKALLSPVCSARVVQQWPDADASADTVMLALH
ARRSAESIAHWAHAHPGRGLGVVLTGTDLYQDIGSDPQAQRSLQLAQRLV
VLQALGAEALPPECRAKARVVYQSTSARAELPKSARQLRAVMVGHLRQVK
SPQTLFDAARLLCGREDIRIDHIGDAGDAGLGELARALASDCPGYRWLGA
LPHAQTRQRIQRAHVLVHTSALEGGAHVIMEAVRSGTPVLASRVPGNVGM
LGNDYAGYFPHGDAAALAALLEACRAGQAGLLDSLRTQCALRAPLFDPRA
EQAALFQLLNELQP

3D structure

• PDB: 8jjn Structure of SenB in complex with UDP-Glc and PO4- at 1.98 Angstroms resolution
• Chain: B
• Resolution: 1.98 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UPG	B	G19 N20 R22 T23 T83 Q131 V151 K158 L209 H211 T214 E231 G232 G233 A234 H235 V236 E239	G11 N12 R14 T15 T75 Q123 V143 K150 L201 H203 T206 E223 G224 G225 A226 H227 V228 E231

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 11:56:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jjn', asym_id = 'B', title = 'Structure of SenB in complex with UDP-Glc and PO4- at 1.98 Angstroms resolution'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jjn', asym_id='B', title='Structure of SenB in complex with UDP-Glc and PO4- at 1.98 Angstroms resolution')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0016757', uniprot = '', pdbid = '8jjn', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016757', uniprot='', pdbid='8jjn', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>