Structure of PDB 8jc5 Chain B

Receptor sequence

>8jc5B (length=164) Species: 9606 (Homo sapiens) [Search protein sequence]

KEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTI
KIWDIGGLPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDK
PQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEK
DNIDITLQWLIQHS

3D structure

PDB

8jc5 Mechanistic Insights into the Interactions of Arl8b with the RUN Domains of PLEKHM1 and SKIP.

Chain

Resolution

2.01 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	B	Q29 Y30 S31 G32 K33 T34 T35 F45 S46 E47 M49 P51 T52 G74 N130 K131 D133 L134 S163 K165	Q12 Y13 S14 G15 K16 T17 T18 F28 S29 E30 M32 P34 T35 G57 N113 K114 D116 L117 S146 K148
BS02	MG	B	T34 T52	T17 T35

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0019003	GDP binding
GO:0043014	alpha-tubulin binding
GO:0048487	beta-tubulin binding

	Biological Process
GO:0001778	plasma membrane repair
GO:0002505	antigen processing and presentation of polysaccharide antigen via MHC class II
GO:0002747	antigen processing and presentation following phagocytosis
GO:0007059	chromosome segregation
GO:0008089	anterograde axonal transport
GO:0015031	protein transport
GO:0016197	endosomal transport
GO:0032418	lysosome localization
GO:0034498	early endosome to Golgi transport
GO:0042267	natural killer cell mediated cytotoxicity
GO:0046754	viral exocytosis
GO:0051301	cell division
GO:0061909	autophagosome-lysosome fusion
GO:0090117	endosome to lysosome transport of low-density lipoprotein particle
GO:0090385	phagosome-lysosome fusion
GO:1902774	late endosome to lysosome transport
GO:1902946	protein localization to early endosome
GO:1990927	calcium ion regulated lysosome exocytosis

	Cellular Component
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005768	endosome
GO:0005819	spindle
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0016020	membrane
GO:0030424	axon
GO:0030496	midbody
GO:0031901	early endosome membrane
GO:0031902	late endosome membrane
GO:0042995	cell projection
GO:0045202	synapse
GO:0051233	spindle midzone
GO:0070062	extracellular exosome
GO:0101004	cytolytic granule membrane
GO:1904115	axon cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8jc5, PDBe:8jc5, PDBj:8jc5
PDBsum	8jc5
PubMed	37775038
UniProt	Q9NVJ2\|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B (Gene Name=ARL8B)

[Back to BioLiP]