Structure of PDB 8j8m Chain B

Receptor sequence
>8j8mB (length=463) Species: 9606 (Homo sapiens) [Search protein sequence]
VTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACG
VFSIVGALCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPS
SQYIVALVFATYLLKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAA
TRVQDAFAAAKLLALALIILLGFVQIGKGDVSNLDPNFSFEGTKLDVGNI
VLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIIISLPIVTLVYVLTN
LAYFTTLSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSL
FTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDI
FSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILAC
LFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTT
VLCQKLMQVVPQE
3D structure
PDB8j8m Overall structure of the LAT1-4F2hc bound with tryptophan
ChainB
Resolution3.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 TRP B I63 G65 S66 F252 F400 I20 G22 S23 F209 F357
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0015171 amino acid transmembrane transporter activity
GO:0015173 aromatic amino acid transmembrane transporter activity
GO:0015175 neutral L-amino acid transmembrane transporter activity
GO:0015179 L-amino acid transmembrane transporter activity
GO:0015190 L-leucine transmembrane transporter activity
GO:0015196 L-tryptophan transmembrane transporter activity
GO:0015297 antiporter activity
GO:0015349 thyroid hormone transmembrane transporter activity
GO:0042605 peptide antigen binding
Biological Process
GO:0002720 positive regulation of cytokine production involved in immune response
GO:0003333 amino acid transmembrane transport
GO:0006865 amino acid transport
GO:0010507 negative regulation of autophagy
GO:0010629 negative regulation of gene expression
GO:0014850 response to muscle activity
GO:0015804 neutral amino acid transport
GO:0015807 L-amino acid transport
GO:0015818 isoleucine transport
GO:0015820 L-leucine transport
GO:0015821 methionine transport
GO:0015823 phenylalanine transport
GO:0015824 proline transport
GO:0015827 tryptophan transport
GO:0015828 tyrosine transport
GO:0015829 valine transport
GO:0032328 alanine transport
GO:0032729 positive regulation of type II interferon production
GO:0032740 positive regulation of interleukin-17 production
GO:0032753 positive regulation of interleukin-4 production
GO:0042149 cellular response to glucose starvation
GO:0042908 xenobiotic transport
GO:0055093 response to hyperoxia
GO:0060252 positive regulation of glial cell proliferation
GO:0070327 thyroid hormone transport
GO:0071222 cellular response to lipopolysaccharide
GO:0071230 cellular response to amino acid stimulus
GO:0089718 amino acid import across plasma membrane
GO:0097421 liver regeneration
GO:0150104 transport across blood-brain barrier
GO:1902024 L-histidine transport
GO:1902475 L-alpha-amino acid transmembrane transport
GO:1903577 cellular response to L-arginine
GO:1903801 L-leucine import across plasma membrane
GO:1904556 L-tryptophan transmembrane transport
GO:1905460 negative regulation of vascular associated smooth muscle cell apoptotic process
GO:1905534 positive regulation of L-leucine import across plasma membrane
Cellular Component
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009925 basal plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0016324 apical plasma membrane
GO:0031528 microvillus membrane
GO:0043231 intracellular membrane-bounded organelle
GO:0070062 extracellular exosome
GO:0098591 external side of apical plasma membrane
GO:1990184 amino acid transport complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j8m, PDBe:8j8m, PDBj:8j8m
PDBsum8j8m
PubMed
UniProtQ01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 (Gene Name=SLC7A5)

[Back to BioLiP]