Structure of PDB 8ipj Chain B |
>8ipjB (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMQIFVKTLGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLR |
|
PDB | 8ipj Crystal structure of the Legionella effector protein MavL with ADPR-Ub |
Chain | B |
Resolution | 2.003 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
AR6 |
B |
D39 R42 |
D39 R42 |
|
|
|