Structure of PDB 8ilf Chain B

Receptor sequence

>8ilfB (length=178) Species: 10498 (African swine fever virus BA71V)

GGGGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKM
LNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKT
YQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQ
TLVPLKITTEKELIKELGFTYRIPKKRL

3D structure

• PDB: 8ilf Structural Insight into Polymerase Mechanism via a Chiral Center Generated with a Single Selenium Atom.
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	V80 C81 G82 R84 I124 R127 K131 K136 N138 Y140	V84 C85 G86 R88 I128 R131 K135 K140 N142 Y144
BS02	dna	B	K79 K85	K83 K89
BS03	dna	B	V120 S121 I124 A128 K132	V124 S125 I128 A132 K136
BS04	dna	B	K131 K132	K135 K136
BS05	MN	B	D49 D51	D53 D55
BS06	7Q6	B	G38 S39 R42 N48 D49 D51 H115 F116 T117 G118 V120 L123 R127	G42 S43 R46 N52 D53 D55 H119 F120 T121 G122 V124 L127 R131

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0044423 virion component

External links

• PDB: RCSB:8ilf, PDBe:8ilf, PDBj:8ilf
• PDBsum: 8ilf
• PubMed: 37958741
• UniProt: P42494|DPOLX_ASFB7 Repair DNA polymerase X (Gene Name=Ba71V-97)