Structure of PDB 8ijl Chain B

Receptor sequence

>8ijlB (length=266) Species: 10114 (Rattus) [Search protein sequence]

TGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGL
TQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCG
SMPSEPKERGEFNHERGERKVCRFKLDWLGNCSGLNDESYGYKEGKPCII
IKLNRVLGFKPKPPKNYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGFYG
FPLQYYPYYGKLLQPKYLQPLLAVQFTNLTLDTEIRIECKAYGENIGYSE
KDRFQGRFDVKIEVKS

3D structure

PDB

8ijl An unusual conformation from Na + -sensitive non-gastric proton pump mutants reveals molecular mechanisms of cooperative Na + -binding.

Chain

Resolution

2.62 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	B	W32 Y39 Y43	W5 Y12 Y16
BS02	Q7G	B	G52 L59	G25 L32

Gene Ontology

	Molecular Function
GO:0001671	ATPase activator activity
GO:0005391	P-type sodium:potassium-exchanging transporter activity
GO:0005515	protein binding
GO:0019901	protein kinase binding
GO:0030674	protein-macromolecule adaptor activity
GO:0046982	protein heterodimerization activity
GO:0051117	ATPase binding

	Biological Process
GO:0001666	response to hypoxia
GO:0001824	blastocyst development
GO:0006813	potassium ion transport
GO:0006814	sodium ion transport
GO:0006874	intracellular calcium ion homeostasis
GO:0006883	intracellular sodium ion homeostasis
GO:0007155	cell adhesion
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient
GO:0010468	regulation of gene expression
GO:0010882	regulation of cardiac muscle contraction by calcium ion signaling
GO:0030001	metal ion transport
GO:0030007	intracellular potassium ion homeostasis
GO:0035725	sodium ion transmembrane transport
GO:0036376	sodium ion export across plasma membrane
GO:0045087	innate immune response
GO:0046034	ATP metabolic process
GO:0050821	protein stabilization
GO:0055119	relaxation of cardiac muscle
GO:0060048	cardiac muscle contraction
GO:0072659	protein localization to plasma membrane
GO:0086009	membrane repolarization
GO:0098655	monoatomic cation transmembrane transport
GO:1903169	regulation of calcium ion transmembrane transport
GO:1903278	positive regulation of sodium ion export across plasma membrane
GO:1903288	positive regulation of potassium ion import across plasma membrane
GO:1990573	potassium ion import across plasma membrane

	Cellular Component
GO:0005886	plasma membrane
GO:0005890	sodium:potassium-exchanging ATPase complex
GO:0005901	caveola
GO:0014704	intercalated disc
GO:0016020	membrane
GO:0016323	basolateral plasma membrane
GO:0016324	apical plasma membrane
GO:0016328	lateral plasma membrane
GO:0030315	T-tubule
GO:0031090	organelle membrane
GO:0036126	sperm flagellum
GO:0042383	sarcolemma

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ijl, PDBe:8ijl, PDBj:8ijl
PDBsum	8ijl
PubMed	37482134
UniProt	P07340\|AT1B1_RAT Sodium/potassium-transporting ATPase subunit beta-1 (Gene Name=Atp1b1)

[Back to BioLiP]