Structure of PDB 8ifo Chain B

Receptor sequence
>8ifoB (length=80) Species: 9606 (Homo sapiens) [Search protein sequence]
PKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEIT
KRRRKSCQACRFMKCLKVGMLKEGVRLDRV
3D structure
PDB8ifo ERR gamma-DBD undergoes dimerization and conformational rearrangement upon binding to the downstream site of the DR1 element
ChainB
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B Y138 H139 Y140 K149 K153 V198 R199 Y15 H16 Y17 K26 K30 V75 R76
BS02 dna B E146 A147 R154 R177 Q181 R184 E23 A24 R31 R54 Q58 R61
BS03 ZN B C164 C170 C180 C183 C41 C47 C57 C60
BS04 ZN B C128 C131 C148 C5 C8 C25
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8ifo, PDBe:8ifo, PDBj:8ifo
PDBsum8ifo
PubMed36944284
UniProtP62508|ERR3_HUMAN Estrogen-related receptor gamma (Gene Name=ESRRG)

[Back to BioLiP]