Structure of PDB 8id2 Chain B |
>8id2B (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] |
FQGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGM PAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERG |
|
PDB | 8id2 Structural insights into recognition of SL4, the UUCG stem-loop, of human U1 snRNA by the ubiquitin-like domain, including the C-terminal tail in the SF3A1 subunit of U2 snRNP. |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
|