Structure of PDB 8iag Chain B

Receptor sequence
>8iagB (length=223) Species: 326644 (Daldinia caldariorum) [Search protein sequence]
PWKAPGPDDVRGPCPMLNTLANHGFLPHDGKNIDVNTTVNALSSALNLDD
ELSRDLHTFAVTTNPQPNATWFSLNHLSRHNVLEHDASLSRQDAYFGPPD
VFNAAVFNETKAYWTGDIINFQMAANALTARLMTSNLTNPEFSMSQLGRG
FGLGETVCYVTILGSKETRTVPKAFVEYLFENERLPYELGFKKMKSALTE
DELTTMMGEIYSLQHLPESFTKP
3D structure
PDB8iag Crystal structure of rDcaUPO A161C mutant from Daldinia caldariorum
ChainB
Resolution1.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B P16 C17 P18 M19 L20 L59 E87 H88 S91 L92 S93 E158 C161 Y162 F183 P13 C14 P15 M16 L17 L56 E84 H85 S88 L89 S90 E155 C158 Y159 F180
BS02 MG B E87 H88 S91 E84 H85 S88
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Nov 27 21:44:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8iag', asym_id = 'B', title = 'Crystal structure of rDcaUPO A161C mutant from Daldinia caldariorum'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8iag', asym_id='B', title='Crystal structure of rDcaUPO A161C mutant from Daldinia caldariorum')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004601', uniprot = '', pdbid = '8iag', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004601', uniprot='', pdbid='8iag', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>