Structure of PDB 8hig Chain B

Receptor sequence
>8higB (length=90) Species: 405948 (Saccharopolyspora erythraea NRRL 2338) [Search protein sequence]
VGDLVIEESTYTARLKALELTYKEFELLKYLAQHAGRVFTRAQLLQEVWG
YDFGTRTVDVHVRRLRAKLGPEYDSMIGTVRNVGYKFVRP
3D structure
PDB8hig Co-crystal structure of C-terminal DNA binding domain of Saccharopolyspora erythraea GlnR in complex with its cognate promoter DNA
ChainB
Resolution2.329 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B T149 K151 W177 F181 T187 R194 T21 K23 W49 F53 T57 R64
BS02 dna B R169 R186 D189 T209 R211 N212 Y215 R41 R56 D59 T79 R81 N82 Y85
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hig, PDBe:8hig, PDBj:8hig
PDBsum8hig
PubMed
UniProtA4FQD5

[Back to BioLiP]