Structure of PDB 8he6 Chain B |
>8he6B (length=120) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] |
MTISLNHTIVPAHNKEASAQFFAQIFGLNVSSVGHFAAVRVNDTLTLDFD DRETFESHHYAFHVSDEEFDTIFARIKQAGLEYSSDPMHHNKGEINHRKG GRGFYFYDPNGHNLELLTLS |
|
PDB | 8he6 Crystal structure of a fosfomycin and bleomycin resistant protein (ALL3014) from Anabaena/Nostoc cyanobacterium at 1.70 A resolution |
Chain | B |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
N42 L45 |
N42 L45 |
|
|
|