Structure of PDB 8hbm Chain B

Receptor sequence
>8hbmB (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]
DELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDM
YMRRKCQECRLRKCKEMGMLAEC
3D structure
PDB8hbm Structural basis of the farnesoid X receptor/retinoid X receptor heterodimer on inverted repeat DNA
ChainB
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B E145 R153 R176 R177 Q180 R183 E22 R30 R53 R54 Q57 R60
BS02 dna B Y137 H138 Y139 R152 R177 K178 C196 Y14 H15 Y16 R29 R54 K55 C73
BS03 ZN B C127 C130 C147 C4 C7 C24
BS04 ZN B C163 C169 C179 C182 C40 C46 C56 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8hbm, PDBe:8hbm, PDBj:8hbm
PDBsum8hbm
PubMed37287811
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]