Structure of PDB 8h1b Chain B

Receptor sequence

>8h1bB (length=193) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MKLERILPFSKTLIKQHITPESIVVDATCGNGNDTLFLAEQVPEGHVYGF
DIQDLALENTRDKVKDFNHVSLIKDGHENIEHHINDAHKGHIDAAIFNLG
YLPKGDKSIVTKPDTTIQAINSLLSLMSIEGIIVLVIYHGHSEGQIEKHA
LLDYLSTLDQKHAQVLQYQFLNQRNHAPFICAIEKISGHHHHH

3D structure

• PDB: 8h1b Identification of a novel 5-aminomethyl-2-thiouridine methyltransferase in tRNA modification.
• Chain: B
• Resolution: 1.55 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.61: tRNA 5-(aminomethyl)-2-thiouridylate-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	R5 K11 N33 D34 N98 G100 Y101 P103 K104 K107 Y138 H141 Q173 R174 N175 A177 P178	R5 K11 N33 D34 N98 G100 Y101 P103 K104 K107 Y138 H141 Q173 R174 N175 A177 P178
BS02	SAM	B	T28 C29 G30 N31 N33 D34 D51 I52 Q53 G76 H77 N98 L99 G100 Y101 L102 T111	T28 C29 G30 N31 N33 D34 D51 I52 Q53 G76 H77 N98 L99 G100 Y101 L102 T111

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity

Biological Process

• GO:0008033 tRNA processing
• GO:0032259 methylation

External links

• PDB: RCSB:8h1b, PDBe:8h1b, PDBj:8h1b
• PDBsum: 8h1b
• PubMed: 36762482
• UniProt: Q2FXG9|MNMM_STAA8 tRNA (mnm(5)s(2)U34)-methyltransferase (Gene Name=mnmM)