Structure of PDB 8gz3 Chain B

Receptor sequence

>8gz3B (length=529) Species: 9606 (Homo sapiens)

EGLSIFVILVWLGLNVFLFVWYYRVYDIPPKFFYTRKLLGSALALARAPA
ACLNFNCMLILLPVCRNLLSFLRGSSSTRVRRQLDRNLTFHKMVAWMIAL
HSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRI
KNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRSYFEVFWYTHH
LFVIFFIGLAIHGAERIVRGQTAESLAVHNITVCEQKISEWGKIKECPIP
QFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIEL
QMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPF
ASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQ
ERNNAGFLSYNIYLTGWQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGP
EALAETLSKQSISNSESGPRGVHFIFNKE

3D structure

• PDB: 8gz3 Structure of human phagocyte NADPH oxidase in the resting state.
• Chain: B
• Resolution: 3.3 Å

Enzymatic activity

• Enzyme Commision number: 1.-.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	R199 S200 F202 Y324 H338 P339 F340 T341 R356 V358 G359 D360 W361 T362	R189 S190 F192 Y314 H328 P329 F330 T331 R346 V348 G349 D350 W351 T352
BS02	HEM	B	A57 H115 T116 H119 A175 G179 I182 L219 H222 R226 I227 P267 T269	A50 H105 T106 H109 A165 G169 I172 L209 H212 R216 I217 P257 T259
BS03	HEM	B	V71 H101 A105 S193 F205 H209 F212 Y280 R287	V64 H91 A95 S183 F195 H199 F202 Y270 R277
BS04	LBN	B	L45 G47 S48 L52 I117 F121 W125	L38 G40 S41 L45 I107 F111 W115

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0016175 superoxide-generating NAD(P)H oxidase activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0046982 protein heterodimerization activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0050664 oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor

Biological Process

• GO:0006801 superoxide metabolic process
• GO:0006952 defense response
• GO:0006954 inflammatory response
• GO:0007584 response to nutrient
• GO:0009410 response to xenobiotic stimulus
• GO:0032760 positive regulation of tumor necrosis factor production
• GO:0034220 monoatomic ion transmembrane transport
• GO:0042554 superoxide anion generation
• GO:0045087 innate immune response
• GO:0045730 respiratory burst
• GO:0045766 positive regulation of angiogenesis
• GO:0050665 hydrogen peroxide biosynthetic process
• GO:0071276 cellular response to cadmium ion
• GO:0071361 cellular response to ethanol
• GO:0071456 cellular response to hypoxia
• GO:0097411 hypoxia-inducible factor-1alpha signaling pathway
• GO:1904044 response to aldosterone
• GO:1904845 cellular response to L-glutamine
• GO:1990776 response to angiotensin

Cellular Component

• GO:0005635 nuclear envelope
• GO:0005737 cytoplasm
• GO:0005789 endoplasmic reticulum membrane
• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0030425 dendrite
• GO:0030670 phagocytic vesicle membrane
• GO:0034702 monoatomic ion channel complex
• GO:0035579 specific granule membrane
• GO:0043020 NADPH oxidase complex
• GO:0043025 neuronal cell body
• GO:0045335 phagocytic vesicle
• GO:0070821 tertiary granule membrane
• GO:0097038 perinuclear endoplasmic reticulum

External links

• PDB: RCSB:8gz3, PDBe:8gz3, PDBj:8gz3
• PDBsum: 8gz3
• PubMed: 36413210
• UniProt: P04839|CY24B_HUMAN Cytochrome b-245 heavy chain (Gene Name=CYBB)