Structure of PDB 8gy2 Chain B

Receptor sequence

>8gy2B (length=433) Species: 290633 (Gluconobacter oxydans 621H)

ADEALIKRGEYVARLSDCIACHTALHGQPYAGGLEIKSPIGTIYSTNITP
DPEHGIGNYTLEDFTKALRKGIRKDGATVYPAMPYPEFARLSDDDIRAMY
AFFMHGVKPVALQNKAPDISWPLSMRWPLGMWRAMFVPSMTPGVDKSISD
PEVARGEYLVNGPGHCGECHTPRGFGMQVKAYGTAGGNAYLAGGAPIDNW
IAPSLRSNSDTGLGRWSEDDIVTFLKSGRIDHSAVFGGMADVVAYSTQHW
SDDDLRATAKYLKSMPAVPEGKNLGQDDGQTTALLNKGGQGNAGAEVYLH
NCAICHMNDGTGVNRMFPPLAGNPVVITDDPTSLANVVAFGGILPPTNSA
PSAVAMPGFKNHLSDQEMADVVNFMRKGWGNNAPGTVSASDIQKLRTTGA
PVSTAGWNVSSKGWMAYMPQPYGEDWTFSPQTH

3D structure

• PDB: 8gy2 Experimental and Theoretical Insights into Bienzymatic Cascade for Mediatorless Bioelectrochemical Ethanol Oxidation with Alcohol and Aldehyde Dehydrogenases
• Chain: B
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 1.1.5.5: alcohol dehydrogenase (quinone).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	B	M354 S390	M316 S352
BS02	HEC	B	C56 C59 H60 T84 I86 Y97 L106 R111 V117 Y118 M121 F126 R164 H203	C18 C21 H22 T46 I48 Y59 L68 R73 V79 Y80 M83 F88 R126 H165
BS03	HEC	B	C204 C207 H208 I239 A240 P241 L243 W254 F262 F274 M277 P362	C166 C169 H170 I201 A202 P203 L205 W216 F224 F236 M239 P324
BS04	HEC	B	A272 V273 F274 N339 C340 C343 H344 F355 P356 L358 G380 V392 M394 F397 M413 F466	A234 V235 F236 N301 C302 C305 H306 F317 P318 L320 G342 V354 M356 F359 M375 F428
BS05	U10	B	C59 L72 P77 P119 L167 W170 E206 R211 I235 D279	C21 L34 P39 P81 L129 W132 E168 R173 I197 D241

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0016614 oxidoreductase activity, acting on CH-OH group of donors
• GO:0020037 heme binding

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8gy2, PDBe:8gy2, PDBj:8gy2
• PDBsum: 8gy2
• UniProt: Q47945|ADHB_GLUOX Alcohol dehydrogenase (quinone), cytochrome c subunit (Gene Name=adhB)