Structure of PDB 8gsg Chain B

Receptor sequence
>8gsgB (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
3D structure
PDB8gsg T3R3 insulin with single Zn
ChainB
Resolution2.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 T30 F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 T30
BS02 CRS B V2 Q4 V2 Q4
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8gsg, PDBe:8gsg, PDBj:8gsg
PDBsum8gsg
PubMed
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]