Structure of PDB 8gs8 Chain B

Receptor sequence
>8gs8B (length=239) Species: 9606 (Homo sapiens) [Search protein sequence]
TAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVD
STLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMY
VIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLY
ECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKL
QDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
3D structure
PDB8gs8 Structure of the human respiratory complex II.
ChainB
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.3.5.1: succinate dehydrogenase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES B C93 R94 C98 G99 S100 C101 C113 C59 R60 C64 G65 S66 C67 C79
BS02 SF4 B C186 C189 C192 A210 C253 C152 C155 C158 A176 C219
BS03 F3S B C196 Y206 P209 C243 H244 T245 I246 M247 N248 C249 C162 Y172 P175 C209 H210 T211 I212 M213 N214 C215
BS04 UQ1 B P197 W201 I246 P163 W167 I212
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008177 succinate dehydrogenase (quinone) activity
GO:0009055 electron transfer activity
GO:0016491 oxidoreductase activity
GO:0046872 metal ion binding
GO:0048039 ubiquinone binding
GO:0051536 iron-sulfur cluster binding
GO:0051537 2 iron, 2 sulfur cluster binding
GO:0051538 3 iron, 4 sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006099 tricarboxylic acid cycle
GO:0006121 mitochondrial electron transport, succinate to ubiquinone
GO:0009060 aerobic respiration
GO:0022904 respiratory electron transport chain
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005886 plasma membrane
GO:0031966 mitochondrial membrane
GO:0045273 respiratory chain complex II (succinate dehydrogenase)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8gs8, PDBe:8gs8, PDBj:8gs8
PDBsum8gs8
PubMed37098072
UniProtP21912|SDHB_HUMAN Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (Gene Name=SDHB)

[Back to BioLiP]