Structure of PDB 8gj1 Chain B

Receptor sequence

>8gj1B (length=367) Species: 83333 (Escherichia coli K-12)

SYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGK
TSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKV
EDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVK
FLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPR
ALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALS
LVEAMVEANGERVMALINEAAARGIEWEALLVEMLGLLHRIAMVQLSPAA
LGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVEM
TLLRALAFHPRMPLPEP

3D structure

• PDB: 8gj1 Structural characterisation of the complete cycle of sliding clamp loading in E. coli
• Chain: B
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	L327 Y328 R355 L357 A358 H360 P361 R362 P364 E367	L326 Y327 R354 L356 A357 H359 P360 R361 P363 E366
BS02	dna	B	V101 S132 H134	V100 S131 H133
BS03	ADP	B	A7 R11 V19 G48 V49 G50 K51 T52 S53 L214 R215	A6 R10 V18 G47 V48 G49 K50 T51 S52 L213 R214
BS04	ALF	B	E127 R215	E126 R214
BS05	ZN	B	C76 C79	C75 C78

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0071897 DNA biosynthetic process
• GO:0075523 viral translational frameshifting

Cellular Component

• GO:0009360 DNA polymerase III complex
• GO:0030894 replisome
• GO:0043846 DNA polymerase III, clamp loader complex

External links

• PDB: RCSB:8gj1, PDBe:8gj1, PDBj:8gj1
• PDBsum: 8gj1
• UniProt: P06710|DPO3X_ECOLI DNA polymerase III subunit tau (Gene Name=dnaX)