Structure of PDB 8g7i Chain B |
>8g7iB (length=138) Species: 1396 (Bacillus cereus) [Search protein sequence] |
MLNGINHLCFSVSNLEDSIEFYEKVLEGELLVRGRKLAYFNICGVWVALN EEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRD CESIYFVDPDGHKFEFHSGTLQDRLNYYREDKPHMTFY |
|
PDB | 8g7i Identification and analysis of small molecule inhibitors of FosB from Staphylococcus aureus. |
Chain | B |
Resolution | 1.83 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H66 E115 |
H66 E115 |
|
|
|
|