Structure of PDB 8g4a Chain B |
>8g4aB (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] |
PTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLR DSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIIC TNTNVK |
|
PDB | 8g4a Use of High Pressure NMR Spectroscopy to Rapidly Identify Proteins with Internal Ligand-Binding Voids |
Chain | B |
Resolution | 1.97 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
YL8 |
B |
I364 R366 F375 I458 |
I5 R7 F16 I99 |
|
|
|