Structure of PDB 8g39 Chain B

Receptor sequence

>8g39B (length=374) Species: 9796 (Equus caballus)

STAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDD
QVVSGTLVTPLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKC
RVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCRGKPIHHFLGTSTFSQYT
VVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTQGSTCAVFGL
GGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQDYKKPI
QEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQN
LSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVL
PFEKINEGFDLLRSGESIRTILTF

3D structure

• PDB: 8g39 Atomic-resolution structures of horse liver alcohol dehydrogenase with NAD(+) and fluoroalcohols define strained Michaelis complexes.
• Chain: B
• Resolution: 1.42 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.1: alcohol dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	C46 H67 C174	C46 H67 C174
BS02	ZN	B	C97 C100 C103 C111	C97 C100 C103 C111
BS03	NAI	B	C46 R47 S48 Q51 C174 T178 G199 G201 V203 D223 I224 K228 I269 V292 G293 V294 I318	C46 R47 S48 Q51 C174 T178 G199 G201 V203 D223 I224 K228 I269 V292 G293 V294 I318
BS04	CXF	B	S48 L57 H67 F93 C174 V294	S48 L57 H67 F93 C174 V294

Gene Ontology

Molecular Function

• GO:0004022 alcohol dehydrogenase (NAD+) activity
• GO:0004745 all-trans-retinol dehydrogenase (NAD+) activity
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0042572 retinol metabolic process
• GO:0042573 retinoic acid metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8g39, PDBe:8g39, PDBj:8g39
• PDBsum: 8g39
• UniProt: P00327|ADH1E_HORSE Alcohol dehydrogenase E chain