Structure of PDB 8fz4 Chain B |
>8fz4B (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] |
SARRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSS QATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGL KTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYAVGVLDFEQAQLE RIADSKEQVFPVKGGFQALKGIINSIL |
|
PDB | 8fz4 Increasing the bulk of the 1TEL-target linker and retaining the 10×His tag in a 1TEL-CMG2-vWa construct improves crystal order and diffraction limits. |
Chain | B |
Resolution | 2.19 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
S52 S54 T118 |
S15 S17 T81 |
|
|
|