Structure of PDB 8ftt Chain B |
>8fttB (length=128) Species: 32630 (synthetic construct) [Search protein sequence] |
EVQLQASGGGFVQPGGSLRLSCAASGATSERDIMGWFRQAPGKEREFVSA ISYEPGGWHYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCAWQ EIMYGEAYWRYWGQGTQVTVSSENLYFQ |
|
PDB | 8ftt Deciphering the orthorhombic crystal structure of a novel NEIL1 nanobody with pseudo-merohedral twinning. |
Chain | B |
Resolution | 2.08 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
SO4 |
B |
H61 S74 R75 |
H59 S72 R73 |
|
|
|