Structure of PDB 8fij Chain B

Receptor sequence
>8fijB (length=186) Species: 9606 (Homo sapiens) [Search protein sequence]
RHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMQHRGFLHNQAK
NLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEV
RAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFKH
CWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQN
3D structure
PDB8fij DNA-based inhibitors restrict mutagenic activity of APOBEC3 in cells
ChainB
Resolution2.799 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.5.4.38: single-stranded DNA cytosine deaminase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B G27 R28 H29 T31 N57 A59 K60 H70 A71 E72 W98 C101 Y130 D131 Y132 G18 R19 H20 T22 N47 A49 K50 H60 A61 E62 W88 C91 Y120 D121 Y122
BS02 ZN B H70 C106 H60 C96
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003824 catalytic activity
GO:0004126 cytidine deaminase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding
Biological Process
GO:0010526 retrotransposon silencing
GO:0016554 cytidine to uridine editing
GO:0044029 positive regulation of gene expression via chromosomal CpG island demethylation
GO:0044355 clearance of foreign intracellular DNA
GO:0045071 negative regulation of viral genome replication
GO:0045087 innate immune response
GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
GO:0051607 defense response to virus
GO:0070383 DNA cytosine deamination
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fij, PDBe:8fij, PDBj:8fij
PDBsum8fij
PubMed37821454
UniProtP31941|ABC3A_HUMAN DNA dC->dU-editing enzyme APOBEC-3A (Gene Name=APOBEC3A)

[Back to BioLiP]