Structure of PDB 8fca Chain B

Receptor sequence

>8fcaB (length=600) Species: 9606 (Homo sapiens) [Search protein sequence]

NRPILFDIVSRGSTADLDGLLPFLLTHKKRLTDEEFREPSTGKTCLPKAL
LNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQTALHIAIERR
CKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPH
IVNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLL
LLKCARLFPDSNLEAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDT
RHLSRKFKDWAYGPVYSSLYDLSSLDTCGEEASVLEILVYNSKIENRHEM
LAVEPINELLRDKWRKFGAVSFYINVVSYLCAMVIFTLTAYYQPLEGTPP
YPYRTTVDYLRLAGEVITLFTGVLFFFTNIKDLFMQLLYFIYSVLVIVSA
ALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTGTYSIMIQKILFKDL
FRFLLVYLLFMIGYASALVSLLNPDSETFSTFLLDLFKLTIGMGDLEMLS
STKYPVVFIILLVTYIILTFVLLLNMLIALMGETVGQVSKESKHIWKLQW
ATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVDEVNWSH

3D structure

PDB

8fca TRPV4-Rho GTPase complex structures reveal mechanisms of gating and disease.

Chain

Resolution

3.41 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	XS9	B	N474 L523 Y553	N325 L374 Y389
BS02	Y01	B	L670 L671 F674	L483 L484 F487

Gene Ontology

	Molecular Function
GO:0003779	actin binding
GO:0005034	osmosensor activity
GO:0005080	protein kinase C binding
GO:0005216	monoatomic ion channel activity
GO:0005261	monoatomic cation channel activity
GO:0005262	calcium channel activity
GO:0005515	protein binding
GO:0005516	calmodulin binding
GO:0005524	ATP binding
GO:0008017	microtubule binding
GO:0008289	lipid binding
GO:0015275	stretch-activated, monoatomic cation-selective, calcium channel activity
GO:0019901	protein kinase binding
GO:0042169	SH2 domain binding
GO:0042802	identical protein binding
GO:0043014	alpha-tubulin binding
GO:0046872	metal ion binding
GO:0048487	beta-tubulin binding
GO:0051015	actin filament binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001666	response to hypoxia
GO:0002024	diet induced thermogenesis
GO:0006811	monoatomic ion transport
GO:0006816	calcium ion transport
GO:0006874	intracellular calcium ion homeostasis
GO:0006884	cell volume homeostasis
GO:0006970	response to osmotic stress
GO:0006971	hypotonic response
GO:0007015	actin filament organization
GO:0007043	cell-cell junction assembly
GO:0007204	positive regulation of cytosolic calcium ion concentration
GO:0007231	osmosensory signaling pathway
GO:0009612	response to mechanical stimulus
GO:0010628	positive regulation of gene expression
GO:0010759	positive regulation of macrophage chemotaxis
GO:0010977	negative regulation of neuron projection development
GO:0030036	actin cytoskeleton organization
GO:0030103	vasopressin secretion
GO:0031117	positive regulation of microtubule depolymerization
GO:0032755	positive regulation of interleukin-6 production
GO:0032868	response to insulin
GO:0034605	cellular response to heat
GO:0042538	hyperosmotic salinity response
GO:0042593	glucose homeostasis
GO:0043117	positive regulation of vascular permeability
GO:0043622	cortical microtubule organization
GO:0045989	positive regulation of striated muscle contraction
GO:0046330	positive regulation of JNK cascade
GO:0046785	microtubule polymerization
GO:0047484	regulation of response to osmotic stress
GO:0050729	positive regulation of inflammatory response
GO:0050891	multicellular organismal-level water homeostasis
GO:0055085	transmembrane transport
GO:0060351	cartilage development involved in endochondral bone morphogenesis
GO:0070374	positive regulation of ERK1 and ERK2 cascade
GO:0070509	calcium ion import
GO:0070588	calcium ion transmembrane transport
GO:0071470	cellular response to osmotic stress
GO:0071476	cellular hypotonic response
GO:0071477	cellular hypotonic salinity response
GO:0071639	positive regulation of monocyte chemotactic protein-1 production
GO:0071642	positive regulation of macrophage inflammatory protein 1 alpha production
GO:0071651	positive regulation of chemokine (C-C motif) ligand 5 production
GO:0097009	energy homeostasis
GO:0097497	blood vessel endothelial cell delamination
GO:1902656	calcium ion import into cytosol
GO:1903444	negative regulation of brown fat cell differentiation
GO:1903715	regulation of aerobic respiration
GO:2000340	positive regulation of chemokine (C-X-C motif) ligand 1 production

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0005881	cytoplasmic microtubule
GO:0005886	plasma membrane
GO:0005912	adherens junction
GO:0005925	focal adhesion
GO:0005929	cilium
GO:0009986	cell surface
GO:0016020	membrane
GO:0016324	apical plasma membrane
GO:0030027	lamellipodium
GO:0030175	filopodium
GO:0030426	growth cone
GO:0030864	cortical actin cytoskeleton
GO:0032587	ruffle membrane
GO:0070161	anchoring junction

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fca, PDBe:8fca, PDBj:8fca
PDBsum	8fca
PubMed	37353484
UniProt	Q9HBA0\|TRPV4_HUMAN Transient receptor potential cation channel subfamily V member 4 (Gene Name=TRPV4)

[Back to BioLiP]