Structure of PDB 8fb1 Chain B

Receptor sequence

>8fb1B (length=248) Species: 9606 (Homo sapiens)

PEAPYASLTEIEHLVQSVSKSYRETCQLRLEDLLRQRSNIFSREEVTGYQ
RKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELSQNDQIVLLKAGAME
VVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSA
LHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHR
QSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS

3D structure

• PDB: 8fb1 Macrocyclic Retinoic Acid Receptor-Related Orphan Receptor C2 Inverse Agonists.
• Chain: B
• Resolution: 2.18 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	4Y5	B	H451 Q460 L463 A464	H192 Q201 L204 A205
BS02	XNR	B	H323 L324 M365 A368 V376 F377 F388 S404 F486	H64 L65 M106 A109 V117 F118 F129 S145 F227
BS03	4Y5	B	L324 T325 I328 Q329 K354 M358 L483 Q484 Q487 A496 A497 F498 L501 Y502 L505 F506	L65 T66 I69 Q70 K95 M99 L224 Q225 Q228 A237 A238 F239 L242 Y243 L246 F247

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004879 nuclear receptor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:8fb1, PDBe:8fb1, PDBj:8fb1
• PDBsum: 8fb1
• PubMed: 36793423
• UniProt: P51449|RORG_HUMAN Nuclear receptor ROR-gamma (Gene Name=RORC)